Pfam domain
Pfam family: YTH (PF04146.14)
Uniprot AC: O74958
RecName: YTH domain-containing protein mmi1
Begin-End: 350-477
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
SRYFIMLCDNETAIAHAKKTSIWAVKKDSSKRISDAYKKASVYFIFVAQQTYNALGYAQV
VSDLNSTELPFWSDSSHAGGVRIKWIKTCNLFSAEISEIVSHMDHGSEARDGMEMMYDEG
SRLCTLIN
Structures of the domain O74958 350-477
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fpq X-ray 1.42 A 350-476 None
5eim X-ray 1.54 A 350-476 None
5eim X-ray 1.54 B 350-476 None
5dno X-ray 1.8 A 349-475 None
6fpx X-ray 1.97 A 350-476 None
6fpx X-ray 1.97 C 350-476 None
6fpx X-ray 1.97 E 350-476 None


© NPIDB team 2003 - 2019

text