Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: O74966
RecName: Small nuclear ribonucleoprotein G
Begin-End: 7-72
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
PDLKKYLDRQVFVQLNGSRKVYGVLRGYDIFLNIVLEDSIEEKVDGEKVKIGSVAIRGNS
VIMIET
Structures of the domain O74966 7-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 o 8-71 None
3jb9 X-ray 3.6 J 6-71 None


© NPIDB team 2003 - 2019

text