Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: O75367
RecName: Core histone macro-H2A.1
Begin-End: 12-88
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb L-Mn 

Sequence:
KTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDN
KKGRVTPRHILLAVAND
Structures of the domain O75367 12-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1u35 X-ray 3 G 1016-1087  H-Bb S-Bb S-Mn 
1u35 X-ray 3 C 816-887  H-Bb S-Bb S-Mn L-Bb 
2f8n X-ray 2.9 G 1014-1087  H-Bb S-Bb S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2019

text