Pfam domain
Pfam family: zf-U1 (PF06220.11)
Uniprot AC: O75554
RecName: WW domain-binding protein 4
Begin-End: 8-44
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRI
Structures of the domain O75554 8-44
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 Q 8-43 None


© NPIDB team 2003 - 2019

text