Pfam domain
Pfam family: AP2 (PF00847.19)
Uniprot AC: O80337
RecName: Ethylene-responsive transcription factor 1A
Begin-End: 146-198
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGS
Structures of the domain O80337 146-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gcc NMR A 145-195  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text