Pfam domain
Pfam family: H2TH (PF06831.13)
Uniprot AC: O80358
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 146-238
Organism: Arabidopsis thaliana
Interaction Mode:   

Sequence:
LGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTAS
SLSKEQCEALHTSIKEVIEKAVEVDADSSQFPS
Structures of the domain O80358 146-238
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3twm X-ray 2.8 B 146-235 None
3twm X-ray 2.8 A 146-235 None


© NPIDB team 2003 - 2019

text