Pfam domain
Pfam family: EFG_IV (PF03764.17)
Uniprot AC: O94316
RecName: Pre-mRNA-splicing factor cwf10
Begin-End: 717-838
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
GKVNINWPQKRISEFFQKNYDWDLLASRSIWAFGPDDRGTNILRDDTLSTDVDKNVLNSV
KEYIKQGFQWGTREGPLCDETIRNVNFRLMDVVLAPEQIYRGGGQIIPTARRVCYSSFLT
AS
Structures of the domain O94316 717-838
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 B 719-838 None


© NPIDB team 2003 - 2019

text