Pfam domain
Pfam family: HhH-GPD (PF00730.24)
Uniprot AC: O94468
RecName: Probable DNA-3-methyladenine glycosylase 2
Begin-End: 46-193
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
IRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHI
VAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTL
KNEAKEFFGLSSKPQTEEVEKLTKPCKP
Structures of the domain O94468 46-193
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4b24 X-ray 2.3 A 46-193 None
4b22 X-ray 1.9 A 46-193 None
4b21 X-ray 1.45 A 46-193 None
4b23 X-ray 2 A 46-193 None
4hsb X-ray 1.9 A 46-193 None


© NPIDB team 2003 - 2019

text