Pfam domain
Pfam family: PRP1_N (PF06424.11)
Uniprot AC: O94906
RecName: Pre-mRNA-processing factor 6
Begin-End: 13-169
Organism: Homo sapiens
Interaction Mode:   

Sequence:
APLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDED
LNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYR
MERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNK
Structures of the domain O94906 13-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 G 23-169 None


© NPIDB team 2003 - 2019

text