Pfam domain
Pfam family: TPR_19 (PF14559.5)
Uniprot AC: O94906
RecName: Pre-mRNA-processing factor 6
Begin-End: 619-684
Organism: Homo sapiens
Interaction Mode:   

Sequence:
WLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVF
MKSVKL
Structures of the domain O94906 619-684
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 G 726-777 None
5o9z X-ray 4.5 G 621-678 None


© NPIDB team 2003 - 2019

text