Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: O94916
RecName: Nuclear factor of activated T-cells 5
Begin-End: 282-439
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb L-Mj 

Sequence:
LKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPH
GFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGI
AGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCT
Structures of the domain O94916 282-439
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1imh X-ray 2.86 D 206-343  H-Bb L-Bb L-Mj 
1imh X-ray 2.86 C 206-343  H-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text