Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: O95238
RecName: SAM pointed domain-containing Ets transcription factor
Begin-End: 250-332
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
HLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSI
RQYYKKGIIRKPDISQRLVYQFV
Structures of the domain O95238 250-332
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1yo5 X-ray 2 C 250-332  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text