Pfam domain
Pfam family: tRNA-synt_2d (PF01409.19)
Uniprot AC: O95363
RecName: Phenylalanine--tRNA ligase, mitochondrial
Begin-End: 219-343
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEME
INFHGEWLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDER
FLKQF
Structures of the domain O95363 219-343
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3tup X-ray 3.05 A 206-307 None


© NPIDB team 2003 - 2019

text