Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: O95551
RecName: Tyrosyl-DNA phosphodiesterase 2
Begin-End: 117-351
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEE
GYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAE
RMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYT
WDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSDH
Structures of the domain O95551 117-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ino X-ray 3.21 B 118-351 None
5ino X-ray 3.21 A 118-351 None


© NPIDB team 2003 - 2020

text