Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: O95644
RecName: Nuclear factor of activated T-cells, cytoplasmic 1
Begin-End: 428-588
Organism: Homo sapiens
Interaction Mode:  L-Bb L-Mj 

Sequence:
LRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLR
PHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELR
KGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECS
Structures of the domain O95644 428-588
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1a66 NMR A 15-175  L-Bb L-Mj 


© NPIDB team 2003 - 2019

text