Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: O95718
RecName: Steroid hormone receptor ERR2
Begin-End: 101-170
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Mj L-Bb 

Sequence:
RLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRF
MKCLKVGMLK
Structures of the domain O95718 101-170
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1lo1 NMR A 102-170  H-Bb H-Mj S-Mj L-Bb 


© NPIDB team 2003 - 2019

text