Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: O95777
RecName: U6 snRNA-associated Sm-like protein LSm8
Begin-End: 4-72
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVR
GDNVAVIGE
Structures of the domain O95777 4-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 8 5-71 None
5o9z X-ray 4.5 u 5-71 None


© NPIDB team 2003 - 2019

text