Pfam domain
Pfam family: RPOL_N (PF14700.8)
Uniprot AC: P00573
RecName: T7 RNA polymerase
Begin-End: 29-202
Organism: Enterobacteria phage T7
Interaction Mode:   

Sequence:
GERLAREQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLLPKMIARINDW
FEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDE
ARFGRIRDLEAKHFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWS
Structures of the domain P00573 29-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e2e X-ray 3 A 35-234  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text