Pfam domain
Pfam family: RPOL_N (PF14700.5)
Uniprot AC: P00573
RecName: T7 RNA polymerase
Begin-End: 35-325
Organism: Enterobacteria phage T7
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
EQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLLPKMIARINDWFEEVKA
KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRI
RDLEAKHFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGV
RCIEMLIESTGMVSLHRQNAGVVGQDSETIELAPEYAEAIATRAGALAGISPMFQPCVVP
PKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAINIAQN
Structures of the domain P00573 35-325
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pi5 X-ray 2.9 A 39-322  H-Bb S-Bb L-Bb L-Mj L-Mn 
1qln X-ray 2.4 A 39-322  H-Bb S-Bb L-Bb L-Mj L-Mn 
1cez X-ray 2.4 A 39-322  H-Bb S-Bb L-Bb L-Mj L-Mn 
2pi4 X-ray 2.5 A 39-322  H-Bb S-Bb L-Bb L-Mj L-Mn 
1h38 X-ray 2.9 A 36-322 None
1h38 X-ray 2.9 C 36-322 None
1h38 X-ray 2.9 D 36-322 None
1h38 X-ray 2.9 B 36-322 None
3e3j X-ray 6.7 C 81-322  L-Bb L-Mj L-Mn 
3e3j X-ray 6.7 B 81-322 None
3e2e X-ray 3 A 36-322  H-Bb S-Bb L-Bb L-Mj L-Mn 
1s0v X-ray 3.2 D 36-322 None
1s0v X-ray 3.2 C 36-322 None
1s0v X-ray 3.2 B 36-322 None
1s0v X-ray 3.2 A 36-322 None


© NPIDB team 2003 - 2020

text