Pfam domain
Pfam family: RPOL_N (PF14700.8)
Uniprot AC: P00573
RecName: T7 RNA polymerase
Begin-End: 35-325
Organism: Enterobacteria phage T7
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
EQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLLPKMIARINDWFEEVKA
KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRI
RDLEAKHFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGV
RCIEMLIESTGMVSLHRQNAGVVGQDSETIELAPEYAEAIATRAGALAGISPMFQPCVVP
PKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAINIAQN
Structures of the domain P00573 35-325
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pi5 X-ray 2.9 A 35-325  H-Bb S-Bb L-Bb L-Mj L-Mn 
1qln X-ray 2.4 A 35-325  H-Bb S-Bb L-Bb L-Mj L-Mn 
1cez X-ray 2.4 A 35-325  H-Bb S-Bb L-Bb L-Mj L-Mn 
3e3j X-ray 6.7 C 35-325  L-Bb L-Mj L-Mn 
3e3j X-ray 6.7 B 35-325  L-Bb L-Mn 
2pi4 X-ray 2.5 A 35-325  H-Bb S-Bb L-Bb L-Mj L-Mn 
1h38 X-ray 2.9 A 35-325  L-Bb 
1h38 X-ray 2.9 B 35-325  L-Bb 
1h38 X-ray 2.9 C 35-325 None
1h38 X-ray 2.9 D 35-325 None
1s0v X-ray 3.2 A 35-325  L-Bb 
1s0v X-ray 3.2 D 35-325 None
1s0v X-ray 3.2 C 35-325 None
1s0v X-ray 3.2 B 35-325  L-Bb 


© NPIDB team 2003 - 2021

text