Pfam domain
Pfam family: Sigma70_ner (PF04546.15)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 138-170
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PEAITYLLEQYDRVEAEEARLSDLITGFVDPNA
Structures of the domain P00579 138-170
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vt0 X-ray 3.78 L 137-213 None


© NPIDB team 2003 - 2021

text