Pfam domain
Pfam family: Sigma70_r4 (PF04545.15)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 547-600
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
VLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
Structures of the domain P00579 547-600
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ylo X-ray 6 F 547-600 None
4ylo X-ray 6 L 547-600 None
4ylo X-ray 6 R 547-600 None
5vt0 X-ray 3.78 L 547-600 None
4ylp X-ray 5.5 R 547-600 None
4ylp X-ray 5.5 F 547-600 None
4ylp X-ray 5.5 L 547-600 None
4yln X-ray 5.5 R 547-600 None
4yln X-ray 5.5 F 547-600 None
4yln X-ray 5.5 L 547-600 None
3t72 X-ray 4.33 q 547-600 None
3t72 X-ray 4.33 o 547-600 None
6b6h X-ray 3.9 F 547-600  H-Bb H-Mj L-Bb L-Mj 
3iyd X-ray 19.8 F 547-600 None
6ca0 X-ray 5.75 F 547-600  H-Bb H-Mj 


© NPIDB team 2003 - 2019

text