Pfam domain
Pfam family: Sigma70_r1_2 (PF00140.19)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 96-128
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DPVRMYMREMGTVELLTREGEIDIAKRIEDGIN
Structures of the domain P00579 96-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ylo X-ray 6 F 96-126 None
4ylo X-ray 6 L 96-126 None
4ylo X-ray 6 R 96-126 None
5vt0 X-ray 3.78 L 96-126 None
4ylp X-ray 5.5 R 96-126 None
4ylp X-ray 5.5 F 96-126 None
4ylp X-ray 5.5 L 96-126 None
4yln X-ray 5.5 R 96-126 None
4yln X-ray 5.5 F 96-126 None
4yln X-ray 5.5 L 96-126 None
6b6h X-ray 3.9 F 96-126 None
6ca0 X-ray 5.75 F 96-126 None


© NPIDB team 2003 - 2019

text