Pfam domain
Pfam family: DNA_pol_A (PF00476.19)
Uniprot AC: P00581
RecName: DNA-directed DNA polymerase
Begin-End: 316-702
Organism: Enterobacteria phage T7
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mn 

Sequence:
DTREYVAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVD
DPEKQAAIDLIKEYLMIQKRIGQSAEGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFP
NLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAHFMARFDNGE
YAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKF
LENTPAIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQ
SAGALICKLWIIKTEEMLVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQE
AMRWVGDHWNFRCLLDTEGKMGPNWAI
Structures of the domain P00581 316-702
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1t8e X-ray 2.54 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
1skw X-ray 2.3 A 331-701 None
1zyq X-ray 2.7 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
1tk8 X-ray 2.5 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
1sl0 X-ray 3.2 A 329-701 None
1sl0 X-ray 3.2 C 329-700 None
1tkd X-ray 2.49 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
2ajq X-ray 2.6 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
2ajq X-ray 2.6 F 331-701  H-Bb S-Bb L-Bb L-Mn 
1x9m X-ray 2.1 A 331-701 None
1x9s X-ray 2.7 A 331-701  H-Bb S-Bb L-Bb L-Mn 
1x9w X-ray 2.3 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
1sl1 X-ray 2.2 A 331-701 None
1sl2 X-ray 2.3 A 331-701 None
1sks X-ray 2.3 A 331-701 None
1t7p X-ray 2.2 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
1tk0 X-ray 2.3 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
1tk5 X-ray 2.2 A 331-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
1skr X-ray 2.4 A 331-701  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text