Pfam domain
Pfam family: DNA_pol_A (PF00476.19)
Uniprot AC: P00582
RecName: DNA polymerase I
Begin-End: 549-926
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PKVLHNHSEELTLRLAELEKKAHEIAGEEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPS
TSEEVLEELALDYPLPKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGR
LSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLLTAFA
EGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIPRKEAQKYM
DLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGARRAAAERAAINAPM
QGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCT
RLDVPLLVEVGSGENWDQ
Structures of the domain P00582 549-926
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1d9d X-ray 2.18 A 551-925 None
1ksp X-ray 2.3 A 551-925 None
2kzz X-ray 2.25 A 551-925 None
1kfs X-ray 2.1 A 551-925 None
2kzm X-ray 2.6 A 551-925 None
1krp X-ray 2.2 A 551-925 None
1d9f X-ray 3 A 551-925 None
2kfn X-ray 2.03 A 551-925 None
2kfz X-ray 2.03 A 551-925 None
1d8y X-ray 2.08 A 551-925 None
1qsl X-ray 2.2 A 551-925 None
1kln X-ray 3.2 A 551-925 None


© NPIDB team 2003 - 2019

text