Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: P00639
RecName: Deoxyribonuclease-1
Begin-End: 26-274
Organism: Bos taurus
Interaction Mode:   

Sequence:
AAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDPNTY
HYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSSHST
KVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQWSS
IRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSN
EMALAISDH
Structures of the domain P00639 26-274
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1dnk X-ray 2.3 A 24-252 None
2dnj X-ray 2 A 24-252 None


© NPIDB team 2003 - 2020

text