Pfam domain
Pfam family: EcoRI (PF02963.15)
Uniprot AC: P00642
RecName: Type-2 restriction enzyme EcoRI
Begin-End: 17-273
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj 

Sequence:
SQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPD
LGGTLFVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQGKDIINIRNGLLVGKRGDQDL
MAAGNAIERSHKNISEIANFMLSESHFPYVLFLEGSNFLTENISITRPDGRVVNLEYNSG
ILNRLDRLTAANYGMPINSNLCINKFVNHKDKSIMLQAASIYTQGDGREWDSKIMFEIMF
DISTTSLRVLGRDLFEQ
Structures of the domain P00642 17-273
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ckq X-ray 1.85 A 17-273  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj 
1cl8 X-ray 1.8 A 17-273 None
1eri X-ray 2.5 A 17-273  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj 
2oxv X-ray 1.95 A 17-273  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj 
1qps X-ray 2.5 A 17-273 None
1qri X-ray 2.6 A 17-273  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj 
1qrh X-ray 2.5 A 17-273  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text