Pfam domain
Pfam family: DNA_ligase_A_M (PF01068.23)
Uniprot AC: P00970
RecName: DNA ligase
Begin-End: 135-367
Organism: Enterobacteria phage T4
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb 

Sequence:
QMLASSYDEKGINKNIKFPAFAQLKADGARCFAEVRGDELDDVRLLSRAGNEYLGLDLLK
EELIKMTAEARQIHPEGVLIDGELVYHEQVKKEPEGLDFLFDAYPENSKAKEFAEVAESR
TASNGIANKSLKGTISEKEAQCMKFQVWDYVPLVEIYSLPAFRLKYDVRFSKLEQMTSGY
DKVILIENQVVNNLDEAKVIYKKYIDQGLEGIILKNIDGLWENARSKNLYKFK
Structures of the domain P00970 135-367
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dt1 X-ray 2.75 A 135-367  H-Bb H-Mn S-Bb L-Bb 


© NPIDB team 2003 - 2021

text