Pfam domain
Pfam family: HLH (PF00010.25)
Uniprot AC: P01106
RecName: Myc proto-oncogene protein
Begin-End: 355-407
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj 

Sequence:
KRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQ
Structures of the domain P01106 355-407
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nkp X-ray 1.8 D 502-554  H-Bb H-Mj 
1nkp X-ray 1.8 A 902-954  H-Bb H-Mj 


© NPIDB team 2003 - 2019

text