Pfam domain
Pfam family: C1-set (PF07654.14)
Uniprot AC: P01837
RecName: Immunoglobulin kappa constant
Begin-End: 8-94
Organism: Mus musculus
Interaction Mode:   

Sequence:
VSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYS
MSSTLTLTKDEYERHNSYTCEATHKTS
Structures of the domain P01837 8-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1n5y X-ray 3.1 L 115-200 None
1ehl X-ray 2.4 L 115-200 None


© NPIDB team 2003 - 2019

text