Pfam domain
Pfam family: C1-set (PF07654.14)
Uniprot AC: P01863
RecName: Ig gamma-2A chain C region, A allele
Begin-End: 8-89
Organism: Mus musculus
Interaction Mode:   

Sequence:
VYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSS
VTVTSSTWPSQSITCNVAHPAS
Structures of the domain P01863 8-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ehl X-ray 2.4 H 121-214 None


© NPIDB team 2003 - 2019

text