Pfam domain
Pfam family: C1-set (PF07654.14)
Uniprot AC: P01867
RecName: Ig gamma-2B chain C region
Begin-End: 7-88
Organism: Mus musculus
Interaction Mode:   

Sequence:
VYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSS
VTVPSSTWPSQTVTCSVAHPAS
Structures of the domain P01867 7-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1cbv X-ray 2.66 H 129-209 None


© NPIDB team 2003 - 2019

text