Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02263
RecName: Histone H2A-IV
Begin-End: 3-91
Organism: Gallus gallus
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
GRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAIRND
Structures of the domain P02263 3-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eqz X-ray 2.5 E 4-88  H-Bb S-Bb L-Bb 
1eqz X-ray 2.5 A 4-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text