Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02281
RecName: Histone H2B 1.1
Begin-End: 28-102
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
KKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKR
STITSREIQTAVRLL
Structures of the domain P02281 28-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mgr X-ray 2.3 H 24-97 None
3mgr X-ray 2.3 D 24-97 None
1kx4 X-ray 2.6 D 24-97 None
3utb X-ray 2.2 D 24-97 None
3b6f X-ray 3.45 H 24-97 None
3b6f X-ray 3.45 D 24-97 None
3lel X-ray 2.95 D 24-97 None
3b6g X-ray 3.45 H 24-97 None
3b6g X-ray 3.45 D 24-97 None
1aoi X-ray 2.8 H 24-97  H-Bb S-Bb L-Bb 
1aoi X-ray 2.8 D 24-97  H-Bb S-Bb L-Bb L-Mn 
1f66 X-ray 2.6 D 1229-1297  H-Bb S-Bb L-Bb 
1f66 X-ray 2.6 H 1429-1497  H-Bb S-Bb L-Bb L-Mn 
1s32 X-ray 2.05 D 1224-1297  H-Bb S-Bb L-Bb L-Mn 
3rek X-ray 2.6 D 24-97 None
3rel X-ray 2.7 D 24-97 None
3rej X-ray 2.55 D 24-97 None
3lja X-ray 2.75 H 24-97 None
3lja X-ray 2.75 D 24-97 None
5e5a X-ray 2.81 D 24-97  H-Bb H-Mj S-Bb L-Bb L-Mn 
5f99 X-ray 2.63 D 27-100 None
3mgq X-ray 2.65 D 24-97 None
3mgq X-ray 2.65 H 24-97 None
3mgp X-ray 2.44 H 24-97 None
3mgp X-ray 2.44 D 24-97 None
3mgs X-ray 3.15 H 24-97 None
3mgs X-ray 3.15 D 24-97 None


© NPIDB team 2003 - 2019

text