Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02281
RecName: Histone H2B 1.1
Begin-End: 33-102
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
SRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITS
REIQTAVRLL
Structures of the domain P02281 33-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1p3f X-ray 2.9 H 1429-1497  H-Bb S-Bb L-Bb 
1p3f X-ray 2.9 D 1233-1297  S-Bb L-Bb 
3kwq X-ray 3.5 H 31-97  H-Bb S-Bb L-Bb 
3kwq X-ray 3.5 D 31-97  H-Bb L-Bb 
1p3i X-ray 2.3 H 1430-1497  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 D 1229-1297  H-Bb S-Bb L-Bb L-Mn 
1kx4 X-ray 2.6 H 29-97 None
4j8v X-ray 2.58 D 29-97 None
4j8v X-ray 2.58 H 29-97 None
4j8v X-ray 2.58 D 29-97 None
4j8v X-ray 2.58 H 29-97 None
1kx3 X-ray 2 H 29-97 None
1kx3 X-ray 2 D 29-97 None
1p34 X-ray 2.7 H 1429-1497  H-Bb S-Bb L-Bb 
1p34 X-ray 2.7 D 1231-1297  H-Bb S-Bb L-Bb 
3uta X-ray 2.07 D 29-97 None
3uta X-ray 2.07 H 29-97 None
3utb X-ray 2.2 H 29-97 None
5omx X-ray 2.32 H 31-100 None
5omx X-ray 2.32 D 32-100 None
1p3g X-ray 2.7 D 1231-1297  H-Bb H-Mj S-Bb L-Bb 
1p3g X-ray 2.7 H 1432-1497  H-Bb S-Bb L-Bb 
4j8x X-ray 2.87 D 29-97 None
4j8x X-ray 2.87 H 29-97 None
4j8x X-ray 2.87 D 29-97 None
4j8x X-ray 2.87 H 29-97 None
1p3a X-ray 3 H 1432-1497  H-Bb H-Mj S-Bb L-Bb 
1p3a X-ray 3 D 1233-1297  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 D 1232-1297  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 H 1432-1497  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 H 1433-1497  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 D 1232-1297  H-Bb S-Bb L-Bb 
6esi X-ray 6.3 H 31-97 None
6esi X-ray 6.3 D 32-97 None
3kxb X-ray 3.2 H 28-97  H-Bb H-Mj 
3kuy X-ray 2.9 H 29-97 None
3kuy X-ray 2.9 D 29-97 None
1p3p X-ray 2.7 D 1231-1297  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 H 1428-1497  H-Bb S-Bb L-Bb 
1p3b X-ray 3 H 1432-1497  H-Bb S-Bb L-Bb 
1p3b X-ray 3 D 1230-1297  H-Bb H-Mj S-Bb L-Bb 
3lel X-ray 2.95 H 28-97 None
3lel X-ray 2.95 R 28-97 None
3lel X-ray 2.95 N 28-97 None
3tu4 X-ray 3 D 29-97  H-Bb S-Bb L-Bb L-Mn 
3tu4 X-ray 3 H 29-97  H-Bb S-Bb L-Bb L-Mn 
3tu4 X-ray 3 H 29-97  H-Bb S-Bb L-Bb L-Mn 
3tu4 X-ray 3 D 29-97  H-Bb S-Bb L-Bb L-Mn 
1p3k X-ray 2.9 D 1232-1297  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 H 1430-1497  H-Bb S-Bb L-Bb 
2f8n X-ray 2.9 H 1431-1497  H-Bb H-Mj S-Bb L-Bb 
1m1a X-ray 2.65 H 1429-1497  H-Bb H-Mj S-Bb L-Bb 
1m1a X-ray 2.65 D 1229-1297  H-Bb S-Bb L-Bb 
2nzd X-ray 2.65 H 29-97 None
2nzd X-ray 2.65 D 29-97 None
4xzq X-ray 2.4 H 1431-1497  H-Bb S-Bb L-Bb 
4xzq X-ray 2.4 D 1231-1297  H-Bb S-Bb L-Bb 
4wu9 X-ray 2.6 H 29-97 None
4wu9 X-ray 2.6 D 29-97 None
1p3l X-ray 2.4 D 1232-1297  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 H 1429-1497  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 D 1231-1297  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 H 1431-1497  H-Bb S-Bb L-Bb 
3mvd X-ray 2.9 D 29-97  H-Bb H-Mj S-Bb L-Bb 
3mvd X-ray 2.9 H 29-97  H-Bb S-Bb L-Bb 
3o62 X-ray 3.22 H 29-97  H-Bb L-Bb 
3o62 X-ray 3.22 D 29-97  H-Bb S-Bb L-Bb 
4kgc X-ray 2.69 H 29-97 None
4kgc X-ray 2.69 D 29-97 None
1s32 X-ray 2.05 H 1426-1497  H-Bb S-Bb L-Bb L-Mn 
2fj7 X-ray 3.2 H 31-97 None
2fj7 X-ray 3.2 D 31-97  H-Bb S-Bb L-Bb 
1m19 X-ray 2.3 H 1429-1497  H-Bb S-Bb L-Bb 
1m19 X-ray 2.3 D 1229-1297  H-Bb S-Bb L-Bb 
3rek X-ray 2.6 H 29-97 None
5x0x X-ray 3.97 H 29-97  H-Bb L-Bb 
5x0x X-ray 3.97 D 29-97  L-Bb 
5nl0 X-ray 5.4 D 28-97 None
5nl0 X-ray 5.4 H 28-97 None
5nl0 X-ray 5.4 N 28-97 None
5mlu X-ray 2.8 H 29-97 None
5mlu X-ray 2.8 D 29-97 None
3reh X-ray 2.5 H 29-97 None
3reh X-ray 2.5 D 29-97 None
3rel X-ray 2.7 H 29-97 None
3rej X-ray 2.55 H 29-97 None
1zla X-ray 2.9 H 1431-1497  H-Bb S-Bb L-Bb 
1zla X-ray 2.9 D 1231-1297  H-Bb S-Bb L-Bb 
3rei X-ray 2.65 D 29-97 None
3rei X-ray 2.65 H 29-97 None
3lz0 X-ray 2.5 D 29-97 None
3lz0 X-ray 2.5 H 29-97 None
3ut9 X-ray 2.2 H 27-97 None
3ut9 X-ray 2.2 D 27-97 None
5ong X-ray 2.8 H 29-97 None
5ong X-ray 2.8 D 29-97 None
3lz1 X-ray 2.5 D 29-97 None
3lz1 X-ray 2.5 H 29-97 None
4ld9 X-ray 3.31 H 36-101 None
1m18 X-ray 2.45 H 1429-1497  H-Bb S-Bb L-Bb 
1m18 X-ray 2.45 D 1229-1297  H-Bb H-Mj S-Bb L-Bb 
4j8u X-ray 2.38 H 29-97 None
4j8u X-ray 2.38 D 29-97 None
4j8u X-ray 2.38 D 29-97 None
4j8u X-ray 2.38 H 29-97 None
4r8p X-ray 3.28 H 32-100 None
4r8p X-ray 3.28 D 32-100 None
5onw X-ray 2.8 H 31-97 None
5onw X-ray 2.8 D 27-97 None
5e5a X-ray 2.81 H 29-97  H-Bb S-Bb L-Bb 
5xf6 X-ray 2.63 H 29-97 None
5xf6 X-ray 2.63 D 29-97 None
5x0y X-ray 4.69 H 29-97  H-Bb S-Bb L-Bb 
5x0y X-ray 4.69 D 29-97  H-Bb S-Bb L-Bb 
4wu8 X-ray 2.45 D 29-97 None
4wu8 X-ray 2.45 H 29-97 None
5f99 X-ray 2.63 H 30-100 None
6esf X-ray 3.7 H 29-97 None
6esf X-ray 3.7 D 29-97 None
4zux X-ray 3.82 H 29-97 None
4zux X-ray 3.82 D 29-97 None
4zux X-ray 3.82 R 29-97 None
4zux X-ray 3.82 N 29-97 None
5dnm X-ray 2.81 H 29-97 None
5dnm X-ray 2.81 D 29-97 None
3mnn X-ray 2.5 H 29-97 None
3mnn X-ray 2.5 D 29-97 None
4xuj X-ray 3.18 H 29-97 None
4xuj X-ray 3.18 D 29-97 None
6esh X-ray 5.1 D 32-97 None
5o9g X-ray 4.8 H 29-97 None
5o9g X-ray 4.8 D 29-97 None
4j8w X-ray 2.41 H 29-97 None
4j8w X-ray 2.41 D 29-97 None
4j8w X-ray 2.41 D 29-97 None
4j8w X-ray 2.41 H 29-97 None
4z66 X-ray 2.5 H 1429-1497  H-Bb S-Bb L-Bb 
4z66 X-ray 2.5 D 1229-1297  H-Bb S-Bb L-Bb 
5dnn X-ray 2.8 H 29-97 None
5dnn X-ray 2.8 D 29-97 None
5cp6 X-ray 2.6 H 29-97 None
5cp6 X-ray 2.6 D 29-97 None


© NPIDB team 2003 - 2019

text