Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02281
RecName: Histone H2B 1.1
Begin-End: 5-102
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMN
SFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLL
Structures of the domain P02281 5-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1kx5 X-ray 1.94 H 8-97 None
1kx5 X-ray 1.94 D 8-97 None


© NPIDB team 2003 - 2019

text