Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02283
RecName: Histone H2B
Begin-End: 30-99
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
KRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITS
REIQTAVRLL
Structures of the domain P02283 30-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pyo X-ray 2.43 H 29-97 None
2pyo X-ray 2.43 D 29-97 None
4qlc X-ray 3.5 H 29-97  H-Bb S-Bb L-Bb 
4qlc X-ray 3.5 D 30-97  H-Bb H-Mj S-Bb L-Bb 
2nqb X-ray 2.3 H 1430-1497  H-Bb S-Bb L-Bb 
2nqb X-ray 2.3 D 1229-1297  S-Bb L-Bb 
4x23 X-ray 3.5 H 33-97  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 D 33-97  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 R 33-97  H-Bb H-Mj S-Bb L-Bb 
4x23 X-ray 3.5 N 33-97  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text