Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02293
RecName: Histone H2B.1
Begin-End: 38-105
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISARE
IQTAVRLI
Structures of the domain P02293 38-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kud X-ray 3.2 D 38-103  H-Bb S-Bb L-Bb 
4kud X-ray 3.2 H 37-103  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text