Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02294
RecName: Histone H2B.2
Begin-End: 36-105
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
VRKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISA
REIQTAVRLI
Structures of the domain P02294 36-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jjn X-ray 3.09 H 38-103  H-Bb S-Bb L-Bb 
4jjn X-ray 3.09 D 36-103  H-Bb S-Bb L-Bb L-Mn 
1id3 X-ray 3.1 H 36-103  H-Bb S-Bb L-Bb 
1id3 X-ray 3.1 D 37-103  S-Bb L-Bb 


© NPIDB team 2003 - 2019

text