Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02299
RecName: Histone H3
Begin-End: 39-132
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASE
AYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P02299 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pyo X-ray 2.43 E 37-131 None
2pyo X-ray 2.43 A 37-131 None
4qlc X-ray 3.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
4qlc X-ray 3.5 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
2nqb X-ray 2.3 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
2nqb X-ray 2.3 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
4x23 X-ray 3.5 E 40-131  H-Bb H-Mj S-Bb L-Bb 
4x23 X-ray 3.5 A 40-131  H-Bb H-Mj S-Bb L-Bb 
4x23 X-ray 3.5 O 40-131  H-Bb H-Mj S-Bb L-Bb 
4x23 X-ray 3.5 K 40-131  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text