Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02302
RecName: Histone H3.3C
Begin-End: 21-132
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
LVTKAAKKCAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQRSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P02302 21-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1aoi X-ray 2.8 E 23-131  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text