Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P02302
RecName: Histone H3.3C
Begin-End: 30-132
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
APATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQRSA
VMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P02302 30-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6px3 X-ray 4.1 E 34-131  H-Bb S-Bb L-Bb 
6ftx X-ray 4.5 E 27-131 None
6nzo X-ray 3.8 E 34-131  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text