Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P02302
RecName: Histone H3.3C
Begin-End: 39-132
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQRSAVMALQEASE
AYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P02302 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fq8 X-ray 4.8 E 40-131 None
6fq8 X-ray 4.8 A 38-131 None
1m1a X-ray 2.65 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1m1a X-ray 2.65 A 437-531  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
1aoi X-ray 2.8 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
1m19 X-ray 2.3 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1m19 X-ray 2.3 A 436-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1m18 X-ray 2.45 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1m18 X-ray 2.45 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text