Pfam domain
Pfam family: CENP-T_C (PF15511.5)
Uniprot AC: P02309
RecName: Histone H4
Begin-End: 19-99
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
HRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAK
RKTVTSLDVVYALKRQGRTLY
Structures of the domain P02309 19-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jjn X-ray 3.09 F 31-95  H-Bb S-Bb L-Bb 
4jjn X-ray 3.09 B 31-95  H-Bb H-Mj S-Bb L-Bb 
1id3 X-ray 3.1 F 32-95  H-Bb H-Mj S-Bb L-Bb 
4kud X-ray 3.2 F 31-95  H-Bb H-Mj S-Bb L-Bb 
4kud X-ray 3.2 B 31-95  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text