Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: P02357
RecName: 30S ribosomal protein S5
Begin-End: 11-75
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
LEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKN
LIEVP
Structures of the domain P02357 11-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 B 8-72 None


© NPIDB team 2003 - 2019

text