Pfam domain
Pfam family: Ribosomal_S5_C (PF03719.14)
Uniprot AC: P02357
RecName: 30S ribosomal protein S5
Begin-End: 86-148
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
IGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLK
QLK
Structures of the domain P02357 86-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 B 84-145 None


© NPIDB team 2003 - 2019

text