Pfam domain
Pfam family: Ribosomal_S7 (PF00177.20)
Uniprot AC: P02359
RecName: 30S ribosomal protein S7
Begin-End: 2-149
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELEA
FEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRLA
NELSDAAENKGTAVKKREDVHRMAEANK
Structures of the domain P02359 2-149
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j5s X-ray 7.5 I 1-148 None
2ykr X-ray 9.8 G 1-148 None
5uz4 X-ray 5.8 G 6-148 None
4a2i X-ray 16.5 G 2-148 None
4adv X-ray 13.5 G 2-148 None
5my1 X-ray 7.6 G 2-148 None


© NPIDB team 2003 - 2019

text