Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: P02391
RecName: 50S ribosomal protein L6
Begin-End: 90-165
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
VGVGYRASKQGKKLVLSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIR
AVRPPEPYKGKGIRYE
Structures of the domain P02391 90-165
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 J 83-157 None
1c04 X-ray 5 B 89-163 None


© NPIDB team 2003 - 2019

text