Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: P02407
RecName: 40S ribosomal protein S17-A
Begin-End: 2-126
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRI
QKGPVRGISFKLQEEERERKDQYVPEVSALDLSRSNGVLNVDNQTSDLVKSLGLKLPLSV
INVSA
Structures of the domain P02407 2-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 R 2-116 None
6eml X-ray 3.6 C 2-105 None


© NPIDB team 2003 - 2019

text