Pfam domain
Pfam family: Homeobox (PF00046.28)
Uniprot AC: P02836
RecName: Segmentation polarity homeobox protein engrailed
Begin-End: 456-511
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKK
Structures of the domain P02836 456-511
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hos X-ray 1.9 A 5-58  H-Bb H-Mj L-Bb L-Mn 
2hos X-ray 1.9 B 2-58  H-Bb H-Mj L-Bb 
2hdd X-ray 1.9 B 2-57  H-Bb H-Mj L-Bb 
2hdd X-ray 1.9 A 5-58  H-Bb H-Mj L-Bb L-Mn 
3hdd X-ray 2.2 A 5-58  H-Bb H-Mj L-Bb L-Mn 
3hdd X-ray 2.2 B 3-58  H-Bb H-Mj L-Bb 
1hdd X-ray 2.8 D 3-58  H-Bb H-Mj L-Bb 
1hdd X-ray 2.8 C 3-58  H-Bb H-Mj L-Bb L-Mn 
2hot X-ray 2.19 A 5-58  H-Bb H-Mj L-Bb L-Mn 
2hot X-ray 2.19 B 2-58  H-Bb H-Mj L-Bb 
1du0 X-ray 2 B 103-158  H-Bb H-Mj L-Bb 
1du0 X-ray 2 A 8-58  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text