Pfam domain
Pfam family: Bac_DnaA_C (PF08299.13)
Uniprot AC: P03004
RecName: Chromosomal replication initiator protein DnaA
Begin-End: 376-444
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
IDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHT
TVLHACRKI
Structures of the domain P03004 376-444
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1j1v X-ray 2.1 A 376-444  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text